PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_01110.1_g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 544aa    MW: 60725.9 Da    PI: 4.3624
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_01110.1_g00003.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.61e-52101371128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWk 84 
                              ++pGfrFhPtdeelv +yL++k+ gk+l++ ++i+e+diykvePwdLp  +++k+++ ewyfFs  d+k+ +g ++nrat++gyWk
  Sme2.5_01110.1_g00003.1  10 MAPGFRFHPTDEELVRYYLRRKIIGKPLRF-DAISEIDIYKVEPWDLPgmSRLKTRDLEWYFFSVLDRKHGNGAKTNRATERGYWK 94 
                              579*************************99.99***************6347788888**************************** PP

                      NAM  85 atgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              +tgkd++v++ k ++vg+kktLvf++grapkge+t+Wvmhey+l
  Sme2.5_01110.1_g00003.1  95 TTGKDRAVYH-KAKVVGMKKTLVFHSGRAPKGERTNWVMHEYKL 137
                              **********.9999***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100558.23410160IPR003441NAC domain
SuperFamilySSF1019411.03E-6110160IPR003441NAC domain
PfamPF023657.3E-2812137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009644Biological Processresponse to high light intensity
GO:0009962Biological Processregulation of flavonoid biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 544 aa     Download sequence    Send to blast
MESKGSKKLM APGFRFHPTD EELVRYYLRR KIIGKPLRFD AISEIDIYKV EPWDLPGMSR  60
LKTRDLEWYF FSVLDRKHGN GAKTNRATER GYWKTTGKDR AVYHKAKVVG MKKTLVFHSG  120
RAPKGERTNW VMHEYKLIDE ELDKAGIVQD ALVLCRVFQK SGPGPKNGEK YGAPFVEEEW  180
EEDELEIVPK EEAAEEVEFG DDIFLDGHDL EQILGTDTPV DGAPLPLNCY SEGNASNSGE  240
TSNSFEEAQN WLQQPDEQES FDPSIQQNAN ANPVKHEFMS EPSDSVNAED VDYLLDEPIV  300
TAADNLQFND GAFLEASDLS RPIEVDTSGF DMLEEYLTFF DADEDFQSMG FNSPMMIGGD  360
DHVYDLASLE EKNIGEVTDQ PIAPSEEPED LKKNVASSSK LEPSKFGSDY KYPFMKQASC  420
MLGGIPAPPA FASEFPSKNA AFRINSSSEA SSSSIHVTGL IQITNMTVSG DGMDRLVGKH  480
GNYNVILSLG LSQLGDSSAL LESAVSILPG KTISIVSWCW FYYIFLWVLI LSTTFKIGTF  540
IRAN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A2e-441016620174NAC domain-containing protein 19
3swm_B2e-441016620174NAC domain-containing protein 19
3swm_C2e-441016620174NAC domain-containing protein 19
3swm_D2e-441016620174NAC domain-containing protein 19
3swp_A2e-441016620174NAC domain-containing protein 19
3swp_B2e-441016620174NAC domain-containing protein 19
3swp_C2e-441016620174NAC domain-containing protein 19
3swp_D2e-441016620174NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00059PBMTransfer from AT5G04410Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754441e-176HG975444.1 Solanum pennellii chromosome ch05, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006345843.10.0PREDICTED: NAC domain-containing protein 78-like
TrEMBLK4C2M30.0K4C2M3_SOLLC; Uncharacterized protein
STRINGSolyc05g055470.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31412450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10500.11e-125NAC domain containing protein 53